PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023956-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 208aa    MW: 23872.9 Da    PI: 7.0305
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023956-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.78.3e-112772148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+ Tt E+ l + + +++ ++ Wk+Ia++++ gRt+k++  +wq ++
  WALNUT_00023956-RA 27 KGSLTTKEQSLVISLQAKYDKK-WKKIAAEVP-GRTPKSLDKWWQVFK 72
                        6778******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-111281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-141976IPR009057Homeodomain-like
PROSITE profilePS5129418.7332276IPR017930Myb domain
SMARTSM007178.5E-82674IPR001005SANT/Myb domain
PfamPF002492.8E-82770IPR001005SANT/Myb domain
CDDcd001675.41E-73171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MHAQYPPHAL TRFSDHAKNY LKPGLKKGSL TTKEQSLVIS LQAKYDKKWK KIAAEVPGRT  60
PKSLDKWWQV FKEKQLKQQQ QNQKKKNDNN APEYSDCTDV NIIPVVEFLE KAAQGPYDHI  120
LETFAEKYVL QLAQALHVPV PEWQYGSGAP MYFGARYGSH SVSRVDYVFF DDVDHASLMD  180
EHDLFPYDVF FYHLADAVSI SSSVPFSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594091e-47KF059409.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) mRNA, complete cds.
GenBankKF0595191e-47KF059519.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349281.12e-40PREDICTED: protein rough sheath 2 homolog
RefseqXP_009371007.12e-40PREDICTED: protein rough sheath 2 homolog
SwissprotO809315e-28AS1_ARATH; Transcription factor AS1
TrEMBLA0A0A0L7E64e-39A0A0A0L7E6_CUCSA; Uncharacterized protein
TrEMBLQ2LMD85e-39Q2LMD8_MALDO; MYB92
TrEMBLA0A059PY186e-39A0A059PY18_ARTAN; MYB-related transcription factor
STRINGPOPTR_0017s13950.13e-32(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.18e-25MYB family protein